PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00020090001
Common NameGSBRNA2T00020090001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 149aa    MW: 16991.7 Da    PI: 10.1921
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00020090001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.22.2e-341670155
              G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  GSBRNA2T00020090001 16 KPRLRWTVELHERFVDAVAQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 70
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-331371IPR009057Homeodomain-like
PROSITE profilePS5129412.8011373IPR017930Myb domain
SuperFamilySSF466893.23E-171571IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-241671IPR006447Myb domain, plants
PfamPF002495.7E-91868IPR001005SANT/Myb domain
PfamPF143791.3E-6120136IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVAQLGGPD KATPKTIMRV MGVKGLTLYH  60
LKSHLQKFRL GKQPHKEYGD QSTKEGSRAS AMDIQRNIAS SSGMISRNMN DSNLHLVYLI  120
RMQMEVQRRL HEQLEVVNFF IFYNIHLL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3167191e-146AK316719.1 Arabidopsis thaliana AT1G79430 mRNA, complete cds, clone: RAFL09-57-C07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013726973.18e-84PREDICTED: myb family transcription factor APL
SwissprotQ9SAK55e-84APL_ARATH; Myb family transcription factor APL
TrEMBLA0A078J3701e-109A0A078J370_BRANA; BnaA02g36130D protein
STRINGBra035118.1-P3e-82(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50442750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.23e-85G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]